PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g038040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 247aa    MW: 27069.1 Da    PI: 10.7725
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g038040.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind265.43.1e-814724697301
       GAGA_bind  97 vgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaek 191
                     ++  ++++t+ id +q    +q ++    +  ++ + ++p++    +  e+ ++k + +++ pk+ k k ++kk+++s+k++k+ s  +++k+ek
  Csa06g038040.1  47 HSHIAVPKTTGIDLSQV---SQANPAEGVMVPQSRSFHPPTTIDYRNGVETVEQK-STNQSPPKALKPKTPRKKRSASNKSKKTLSI-PETKREK 136
                     44567888888987777...44444333366777777777665555544444443.4555667777777777777888888888886.699**** PP

       GAGA_bind 192 ksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLk 286
                     k++d++++  s+D+s++P+PvCsCtG++r+CYkWG+GGWqS+CCt++iS+yPLP+st+r+gaR+agrKmS+ga+ klL++La+eGy+ls+pvDLk
  Csa06g038040.1 137 KNLDINIDISSFDTSGVPPPVCSCTGVSRVCYKWGMGGWQSSCCTISISTYPLPMSTTRPGARLAGRKMSNGAYVKLLARLAGEGYSLSHPVDLK 231
                     *********************************************************************************************** PP

       GAGA_bind 287 dhWAkHGtnkfvtir 301
                     +hWA+HGtnkfvt +
  Csa06g038040.1 232 NHWARHGTNKFVTFK 246
                     *************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012267.1E-9817246IPR010409GAGA-binding transcriptional activator
PfamPF062172.6E-6974246IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
ERQRERVISP LKLAIKMNPF PSQNLMLSAT NANKDAALLI SNAHWFHSHI AVPKTTGIDL  60
SQVSQANPAE GVMVPQSRSF HPPTTIDYRN GVETVEQKST NQSPPKALKP KTPRKKRSAS  120
NKSKKTLSIP ETKREKKNLD INIDISSFDT SGVPPPVCSC TGVSRVCYKW GMGGWQSSCC  180
TISISTYPLP MSTTRPGARL AGRKMSNGAY VKLLARLAGE GYSLSHPVDL KNHWARHGTN  240
KFVTFK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0899610.0EU089961.1 Arabidopsis arenosa GAGA-binding transcriptional activator (BBR/BPC7) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010516733.11e-173PREDICTED: protein BASIC PENTACYSTEINE7-like
SwissprotO822861e-140BPC7_ARATH; Protein BASIC PENTACYSTEINE7
TrEMBLR0HUS91e-147R0HUS9_9BRAS; Uncharacterized protein
STRINGAT2G35550.11e-146(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136742127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.11e-141basic pentacysteine 7